Search Antibody, Protein, and ELISA Kit Solutions

RPE Antibody - middle region (ARP56725_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56725_P050-FITC Conjugated

ARP56725_P050-HRP Conjugated

ARP56725_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Ribulose-phosphate 3-epimerase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC2636, RPE2-1
Replacement Item:
This antibody may replace item sc-162124 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPE.
The immunogen is a synthetic peptide directed towards the middle region of human RPE
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-RPE (ARP56725_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RPE (ARP56725_P050) antibody is Catalog # AAP56725 (Previous Catalog # AAPP39532)
Printable datasheet for anti-RPE (ARP56725_P050) antibody
Target Reference:
Veltel,S., (2008) Nat. Struct. Mol. Biol. 15 (4), 373-380

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...