| Product Number |
ARP56725_P050 |
| Product Page |
www.avivasysbio.com/rpe-antibody-middle-region-arp56725-p050.html |
| Name |
RPE Antibody - middle region (ARP56725_P050) |
| Protein Size (# AA) |
228 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
6120 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ribulose-5-phosphate-3-epimerase |
| Alias Symbols |
RPE2-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Veltel,S., (2008) Nat. Struct. Mol. Biol. 15 (4), 373-380 |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
RPE; UBC; MRI1; EXOSC10; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RPE (ARP56725_P050) antibody |
| Blocking Peptide |
For anti-RPE (ARP56725_P050) antibody is Catalog # AAP56725 (Previous Catalog # AAPP39532) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RPE |
| Uniprot ID |
Q96AT9 |
| Protein Name |
Ribulose-phosphate 3-epimerase |
| Protein Accession # |
NP_954699 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006915 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RPE |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Muscle
 | WB Suggested Anti-RPE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
| | Image 2 | Human Adult Liver
 | Rabbit Anti-RPE Antibody
Catalog Number: ARP56725_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm but only in connective tissue cells in the interlobular septum, very low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
|
