SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP72615_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP72615_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-RASGRF1 (ARP72615_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human RASGRF1
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: EVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNG
Concentration0.5 mg/ml
Blocking PeptideFor anti-RASGRF1 (ARP72615_P050-FITC) antibody is Catalog # AAP72615
Gene SymbolRASGRF1
Alias SymbolsGNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1
NCBI Gene Id5923
Description of TargetThe protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Uniprot IDQ13972-2
Protein Accession #NP_722522
Protein Size (# AA)489
Molecular Weight53kDa
Protein InteractionsEHD4; SNRNP70; CEBPA; ADRBK1; MYC; UBC; TNK2; YWHAE; USP8; RAC1; PRKACA; NTRK2; RRAS2; NTRK3; NTRK1; RHOA; YWHAB; PPP1R9B; MARK3; HRAS;
  1. What is the species homology for "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    This target may also be called "GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1" in publications.

  5. What is the shipping cost for "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RASGRF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RASGRF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RASGRF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RASGRF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RASGRF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RASGRF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RASGRF1 Antibody - N-terminal region : FITC (ARP72615_P050-FITC)
Your Rating
We found other products you might like!