PTPN6 Antibody - middle region (ARP87368_P050)

Catalog No: ARP87368_P050

Host: Rabbit
Target Name: PTPN6
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTPN6
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTPN6 (ARP87368_P050) antibody is Catalog # AAP87368

Target Info

• Gene Symbol: PTPN6
• Gene Full Name: protein tyrosine phosphatase, non-receptor type 6
• Alias Symbols: HCP, HCPH, SHP1, SHP-1, HPTP1C, PTP-1C, SHP-1L, SH-PTP1
• NCBI Gene Id: 5777
• Protein Name: tyrosine-protein phosphatase non-receptor type 6
• Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. N-terminal part of this PTP contains two tandem Src homolog (SH2) domains, which act as protein phospho-tyrosine binding domains, and mediate the interaction of this PTP with its substrates. This PTP is expressed primarily in hematopoietic cells, and functions as an important regulator of multiple signaling pathways in hematopoietic cells. This PTP has been shown to interact with, and dephosphorylate a wide spectrum of phospho-proteins involved in hematopoietic cell signaling. Multiple alternatively spliced variants of this gene, which encode distinct isoforms, have been reported.
• Uniprot ID: P29350-2
• Protein Accession #: NP_002822.2
• Nucleotide Accession #: NM_002831.5
• Protein Size (# AA): 556
• Molecular Weight: 61 kDa