- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for SHP-1 Antibody (Phospho-Tyr536) (OAAF07323) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:Y536 Mouse:Y536 Rat:Y538 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyr536. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: EAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAK |
| Concentration | 1mg/ml |
| Specificity | SHP-1 (Phospho-Tyr536) Antibody detects endogenous levels of SHP-1 only when phosphorylated at Tyr536. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:10000 |
| Gene Symbol | PTPN6 |
|---|---|
| Gene Full Name | protein tyrosine phosphatase non-receptor type 6 |
| Alias Symbols | HCP;HCPH;hematopoietic cell phosphatase;hematopoietic cell protein-tyrosine phosphatase;HPTP1C;protein-tyrosine phosphatase 1C;protein-tyrosine phosphatase SHP-1;PTP-1C;SHP1;SHP-1;SHP-1L;SH-PTP1;tyrosine-protein phosphatase non-receptor type 6. |
| NCBI Gene Id | 5777 |
| Protein Name | Tyrosine-protein phosphatase non-receptor type 6 |
| Description of Target | Modulates signaling by tyrosine phosphorylated cell surface receptors such as KIT and the EGF receptor/EGFR. The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates. Together with MTUS1, induces UBE2V2 expression upon angiotensin II stimulation. Plays a key role in hematopoiesis. |
| Uniprot ID | P29350 |
| Molecular Weight | 67 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
This target may also be called "HCP;HCPH;hematopoietic cell phosphatase;hematopoietic cell protein-tyrosine phosphatase;HPTP1C;protein-tyrosine phosphatase 1C;protein-tyrosine phosphatase SHP-1;PTP-1C;SHP1;SHP-1;SHP-1L;SH-PTP1;tyrosine-protein phosphatase non-receptor type 6." in publications.
-
What is the shipping cost for "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "67 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SHP-1 Antibody (Phospho-Tyr536) (OAAF07323)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PTPN6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PTPN6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PTPN6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PTPN6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PTPN6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PTPN6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
