PTF1A Antibody (OAAL00969)

Catalog No: OAAL00969

Size:100UG

Detection limit for recombinant GST tagged PTF1A is approximately 0.1ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 4B1
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: PTF1A (NP_835455, 250 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: PTF1A
• Gene Full Name: pancreas associated transcription factor 1a
• Alias Symbols: bHLH transcription factor p48;bHLHa29;class A basic helix-loop-helix protein 29;class II bHLH protein PTF1A;exocrine pancreas-specific transcription factor p48;p48;p48 DNA-binding subunit of transcription factor PTF1;PACA;PAGEN2;pancreas specific transcription factor, 1a;pancreas transcription factor 1 subunit alpha;PTF1-p48.
• NCBI Gene Id: 256297
• Protein Name: Homo sapiens pancreas associated transcription factor 1a (PTF1A), mRNA|pancreas transcription factor 1 subunit alpha [Homo sapiens]
• Description of Target: This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_835455
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_178161