Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP87361_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

PRKCD Antibody - middle region (ARP87361_P050)

Catalog#: ARP87361_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRKCD
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: ELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PRKCD (ARP87361_P050) antibody is Catalog # AAP87361
Datasheets/Manuals Printable datasheet for anti-PRKCD (ARP87361_P050) antibody
Gene Symbol PRKCD
Official Gene Full Name protein kinase C delta
Alias Symbols MAY1, PKCD, ALPS3, CVID9, nPKC-delta
NCBI Gene Id 5580
Protein Name Protein kinase C delta type
Description of Target Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed.
Swissprot Id Q05655
Protein Accession # NP_001303256.1
Nucleotide Accession # NM_001316327.1
Protein Size (# AA) 676
Molecular Weight 74 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PRKCD.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PRKCD.
  1. What is the species homology for "PRKCD Antibody - middle region (ARP87361_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PRKCD Antibody - middle region (ARP87361_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "PRKCD Antibody - middle region (ARP87361_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRKCD Antibody - middle region (ARP87361_P050)"?

    This target may also be called "MAY1, PKCD, ALPS3, CVID9, nPKC-delta" in publications.

  5. What is the shipping cost for "PRKCD Antibody - middle region (ARP87361_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRKCD Antibody - middle region (ARP87361_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRKCD Antibody - middle region (ARP87361_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRKCD Antibody - middle region (ARP87361_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PRKCD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKCD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKCD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKCD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKCD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKCD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRKCD Antibody - middle region (ARP87361_P050)
Your Rating
We found other products you might like!