Search Antibody, Protein, and ELISA Kit Solutions

PRKCD Antibody - middle region (ARP87361_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
protein kinase C delta
NCBI Gene Id:
Protein Name:
Protein kinase C delta type
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MAY1, PKCD, ALPS3, CVID9, nPKC-delta
Description of Target:
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed.
Protein Size (# AA):
Molecular Weight:
74 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKCD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKCD.
The immunogen is a synthetic peptide directed towards the middle region of human PRKCD
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: ELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRKCD (ARP87361_P050) antibody is Catalog # AAP87361
Printable datasheet for anti-PRKCD (ARP87361_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...