PRKCD Antibody - middle region (ARP87361_P050)

Catalog No: ARP87361_P050

Host: Rabbit
Target Name: PRKCD
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKCD
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRKCD (ARP87361_P050) antibody is Catalog # AAP87361

Target Info

• Gene Symbol: PRKCD
• Gene Full Name: protein kinase C delta
• Alias Symbols: MAY1, PKCD, ALPS3, CVID9, nPKC-delta
• NCBI Gene Id: 5580
• Protein Name: Protein kinase C delta type
• Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed.
• Uniprot ID: Q05655
• Protein Accession #: NP_001303256.1
• Nucleotide Accession #: NM_001316327.1
• Protein Size (# AA): 676
• Molecular Weight: 74 kDa