- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for PRKCD Antibody (OAAL00256) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 8E12 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | PRKCD |
|---|---|
| Gene Full Name | protein kinase C delta |
| Alias Symbols | ALPS3;CVID9;MAY1;nPKC-delta;PKCD;protein kinase C delta type;protein kinase C delta VIII;tyrosine-protein kinase PRKCD. |
| NCBI Gene Id | 5580 |
| Protein Name | Homo sapiens protein kinase C delta (PRKCD), transcript variant 1, mRNA|protein kinase C delta type [Homo sapiens] |
| Description of Target | Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_006245 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_006254 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PRKCD Antibody (OAAL00256)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "PRKCD Antibody (OAAL00256)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "PRKCD Antibody (OAAL00256)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PRKCD Antibody (OAAL00256)"?
This target may also be called "ALPS3;CVID9;MAY1;nPKC-delta;PKCD;protein kinase C delta type;protein kinase C delta VIII;tyrosine-protein kinase PRKCD." in publications.
-
What is the shipping cost for "PRKCD Antibody (OAAL00256)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PRKCD Antibody (OAAL00256)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PRKCD Antibody (OAAL00256)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PRKCD Antibody (OAAL00256)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PRKCD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PRKCD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PRKCD"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PRKCD"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PRKCD"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PRKCD"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
