PRKCD Antibody - middle region (ARP87361_P050)

Data Sheet
 
Product Number ARP87361_P050
Product Page www.avivasysbio.com/prkcd-antibody-middle-region-arp87361-p050.html
Name PRKCD Antibody - middle region (ARP87361_P050)
Protein Size (# AA) 676 amino acids
Molecular Weight 74 kDa
NCBI Gene Id 5580
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name protein kinase C delta
Alias Symbols MAY1, PKCD, ALPS3, CVID9, nPKC-delta
Peptide Sequence Synthetic peptide located within the following region: ELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRKCD (ARP87361_P050) antibody
Blocking Peptide For anti-PRKCD (ARP87361_P050) antibody is Catalog # AAP87361
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRKCD
Uniprot ID Q05655
Protein Name Protein kinase C delta type
Protein Accession # NP_001303256.1
Purification Affinity purified
Nucleotide Accession # NM_001316327.1
Tested Species Reactivity Human
Gene Symbol PRKCD
Predicted Species Reactivity Human
Application WB
Image 1
Human HCT116 Whole Cell
Host: Rabbit
Target Name: PRKCD
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com