Product Number |
ARP87361_P050 |
Product Page |
www.avivasysbio.com/prkcd-antibody-middle-region-arp87361-p050.html |
Name |
PRKCD Antibody - middle region (ARP87361_P050) |
Protein Size (# AA) |
676 amino acids |
Molecular Weight |
74 kDa |
NCBI Gene Id |
5580 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
protein kinase C delta |
Alias Symbols |
MAY1, PKCD, ALPS3, CVID9, nPKC-delta |
Peptide Sequence |
Synthetic peptide located within the following region: ELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PRKCD (ARP87361_P050) antibody |
Blocking Peptide |
For anti-PRKCD (ARP87361_P050) antibody is Catalog # AAP87361 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PRKCD |
Uniprot ID |
Q05655 |
Protein Name |
Protein kinase C delta type |
Protein Accession # |
NP_001303256.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001316327.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
PRKCD |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human HCT116 Whole Cell
| Host: Rabbit Target Name: PRKCD Sample Tissue: Human HCT116 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|