Search Antibody, Protein, and ELISA Kit Solutions

POR Antibody - middle region : HRP (ARP44362_P050-HRP)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44362_P050 Unconjugated

ARP44362_P050-FITC Conjugated

ARP44362_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
P450 (cytochrome) oxidoreductase
NCBI Gene Id:
Protein Name:
NADPH--cytochrome P450 reductase PIRNR PIRNR000208
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CPR, CYPOR, DKFZp686G04235, FLJ26468, P450R
Replacement Item:
This antibody may replace item sc-43715 from Santa Cruz Biotechnology.
Description of Target:
POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express POR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express POR.
The immunogen is a synthetic peptide directed towards the middle region of human POR
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-POR (ARP44362_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-POR (ARP44362_P050-HRP) antibody is Catalog # AAP44362 (Previous Catalog # AAPS14810)
Printable datasheet for anti-POR (ARP44362_P050-HRP) antibody
Additional Information:
IHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Target Reference:
Gomes,L.G., (er) J. Clin. Endocrinol. Metab. (2008) In press

Lee, J. W., Kim, Y. H., Yoon, S. & Lee, S. K. Cytochrome P450 system expression and DNA adduct formation in the liver of Zacco platypus following waterborne Benzo(a)pyrene exposure: implications for biomarker determination. Environ. Toxicol. (2012). doi:10.1002/tox.21833 WB, Bovine, Human, Dog, Rabbit, Guinea pig, Rat, Mouse, Horse, Zebrafish 23192953

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...