Search Antibody, Protein, and ELISA Kit Solutions

POR Antibody - middle region (ARP44362_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44362_P050-FITC Conjugated

ARP44362_P050-HRP Conjugated

ARP44362_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Additional Information:
IHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-43715 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human POR
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-POR (ARP44362_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-POR (ARP44362_P050) antibody is Catalog # AAP44362 (Previous Catalog # AAPS14810)
Datasheets/Manuals:
Printable datasheet for anti-POR (ARP44362_P050) antibody
Target Reference:
Gomes,L.G., (er) J. Clin. Endocrinol. Metab. (2008) In press
Publications:

Lee, J. W., Kim, Y. H., Yoon, S. & Lee, S. K. Cytochrome P450 system expression and DNA adduct formation in the liver of Zacco platypus following waterborne Benzo(a)pyrene exposure: implications for biomarker determination. Environ. Toxicol. 29, 1032-42 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23192953

Gene Symbol:
POR
Official Gene Full Name:
P450 (cytochrome) oxidoreductase
Alias Symbols:
CPR, CYPOR, DKFZp686G04235, FLJ26468, P450R
NCBI Gene Id:
5447
Protein Name:
NADPH--cytochrome P450 reductase PIRNR PIRNR000208
Description of Target:
POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Q63HL4
Protein Accession #:
NP_000932
Nucleotide Accession #:
NM_000941
Protein Size (# AA):
680
Molecular Weight:
77kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express POR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express POR.
Protein Interactions:
UBC; CYP2C9; PGRMC1; STAT1; INSIG1; CYP3A4; CYP2E1; CYP2D6; CYP2C19; CYP2A6; CYP1A2; UBD; SUMO2; RABEPK; FANCC; CYB5A; CYP17A1; XRCC6; HMOX1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...