Catalog No: ARP44362_P050
Price: $0.00
SKU
ARP44362_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-POR (ARP44362_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human POR
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE
Concentration0.5 mg/ml
Blocking PeptideFor anti-POR (ARP44362_P050) antibody is Catalog # AAP44362 (Previous Catalog # AAPS14810)
Enhanced Validation
WBY
SPRY
YCHAROS
ReferenceGomes,L.G., (er) J. Clin. Endocrinol. Metab. (2008) In press
Publications

Lee, J. W., Kim, Y. H., Yoon, S. & Lee, S. K. Cytochrome P450 system expression and DNA adduct formation in the liver of Zacco platypus following waterborne Benzo(a)pyrene exposure: implications for biomarker determination. Environ. Toxicol. (2012). doi:10.1002/tox.21833 23192953

Gene SymbolPOR
Gene Full NameP450 (cytochrome) oxidoreductase
Alias SymbolsCPR, CYPOR, P450R
NCBI Gene Id5447
Protein NameNADPH--cytochrome P450 reductase PIRNR PIRNR000208
Description of TargetPOR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ63HL4
Protein Accession #NP_000932
Nucleotide Accession #NM_000941
Protein Size (# AA)680
Molecular Weight77 kDa
Protein InteractionsUBC; CYP2C9; PGRMC1; STAT1; INSIG1; CYP3A4; CYP2E1; CYP2D6; CYP2C19; CYP2A6; CYP1A2; UBD; SUMO2; RABEPK; FANCC; CYB5A; CYP17A1; XRCC6; HMOX1;
  1. What is the species homology for "POR Antibody - middle region (ARP44362_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "POR Antibody - middle region (ARP44362_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "POR Antibody - middle region (ARP44362_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "POR Antibody - middle region (ARP44362_P050)"?

    This target may also be called "CPR, CYPOR, P450R" in publications.

  5. What is the shipping cost for "POR Antibody - middle region (ARP44362_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "POR Antibody - middle region (ARP44362_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "POR Antibody - middle region (ARP44362_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "77 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "POR Antibody - middle region (ARP44362_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "POR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "POR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "POR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "POR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "POR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "POR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:POR Antibody - middle region (ARP44362_P050)
Your Rating
We found other products you might like!