Search Antibody, Protein, and ELISA Kit Solutions

PKD2 Antibody - middle region (ARP83784_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the middle region of human PKD2
Peptide Sequence:
Synthetic peptide located within the following region: PRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGS
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PKD2 (ARP83784_P050) antibody is Catalog # AAP83784
Printable datasheet for anti-PKD2 (ARP83784_P050) antibody
Gene Symbol:
Official Gene Full Name:
polycystin 2, transient receptor potential cation channel
Alias Symbols:
PC2, PKD4, Pc-2, APKD2, TRPP2
NCBI Gene Id:
Protein Name:
Description of Target:
This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
106 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PKD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PKD2.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...