PKD2 Antibody - middle region (ARP83784_P050)

• Product Number: ARP83784_P050
• Name: PKD2 Antibody - middle region (ARP83784_P050)
• Protein Size (# AA): 968 amino acids
• Molecular Weight: 106 kDa
• NCBI Gene Id: 5311
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: polycystin 2, transient receptor potential cation channel
• Alias Symbols: PC2, PKD4, Pc-2, APKD2, TRPP2
• Peptide Sequence: Synthetic peptide located within the following region: PRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PKD2 (ARP83784_P050) antibody is Catalog # AAP83784
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PKD2
• Uniprot ID: Q13563
• Protein Name: polycystin-2
• Protein Accession #: NP_000288.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_000297.3
• Tested Species Reactivity: Human
• Gene Symbol: PKD2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: PKD2
  Sample Tissue: Human Jurkat Whole Cell lysates
  Antibody Dilution: 1ug/ml