Search Antibody, Protein, and ELISA Kit Solutions

PARL antibody - N-terminal region (ARP44851_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44851_P050-FITC Conjugated

ARP44851_P050-HRP Conjugated

ARP44851_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Presenilin associated, rhomboid-like
Protein Name:
Presenilins-associated rhomboid-like protein, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133884 from Santa Cruz Biotechnology.
Description of Target:
PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PARL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PARL.
The immunogen is a synthetic peptide directed towards the N terminal region of human PARL
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%;
Complete computational species homology data:
Anti-PARL (ARP44851_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PARL (ARP44851_P050) antibody is Catalog # AAP44851 (Previous Catalog # AAPP25930)
Printable datasheet for anti-PARL (ARP44851_P050) antibody
Sample Type Confirmation:

PARL is supported by BioGPS gene expression data to be expressed in Jurkat

Additional Information:
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
Target Reference:
Walder,K., (2005) Diabetologia 48 (3), 459-468

Yoshioka, H. et al. The role of PARL and HtrA2 in striatal neuronal injury after transient global cerebral ischemia. J. Cereb. Blood Flow Metab. 33, 1658-65 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23921894

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...