Product Number |
ARP44851_P050 |
Product Page |
www.avivasysbio.com/parl-antibody-n-terminal-region-arp44851-p050.html |
Name |
PARL Antibody - N-terminal region (ARP44851_P050) |
Protein Size (# AA) |
329 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
55486 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Presenilin associated, rhomboid-like |
Description |
|
Alias Symbols |
PSARL, PSARL1, RHBDS1, PRO2207, PSENIP2 |
Peptide Sequence |
Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Walder,K., (2005) Diabetologia 48 (3), 459-468 |
Description of Target |
PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Protein Interactions |
UBC; PINK1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PARL (ARP44851_P050) antibody |
Additional Information |
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-PARL (ARP44851_P050) antibody is Catalog # AAP44851 (Previous Catalog # AAPP25930) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PARL |
Uniprot ID |
Q9H300-2 |
Protein Name |
Presenilins-associated rhomboid-like protein, mitochondrial |
Publications |
Cholesterol alters mitophagy by impairing optineurin recruitment and lysosomal clearance in Alzheimer's disease. Mol Neurodegener. 16, 15 (2021) 33685483
Yoshioka, H. et al. The role of PARL and HtrA2 in striatal neuronal injury after transient global cerebral ischemia. J. Cereb. Blood Flow Metab. 33, 1658-65 (2013). 23921894 |
Sample Type Confirmation |
PARL is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001032728 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001037639 |
Tested Species Reactivity |
Human |
Gene Symbol |
PARL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Human Jurkat
| Host: Rabbit Target Name: PARL Sample Tissue: Human Jurkat Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human Lung Tissue
| Rabbit Anti-PARL Antibody Catalog Number: ARP44851_P050 Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|