Size:100 ul
$319.00
In stock
SKU
ARP54478_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54478_P050-FITC Conjugated

ARP54478_P050-HRP Conjugated

ARP54478_P050-Biotin Conjugated

NLRP1 Antibody - N-terminal region (ARP54478_P050)

Catalog#: ARP54478_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-116236 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 86%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 85%; Rat: 100%
Complete computational species homology data Anti-NLRP1 (ARP54478_P050)
Peptide Sequence Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NLRP1 (ARP54478_P050) antibody is Catalog # AAP54478 (Previous Catalog # AAPP31258)
Datasheets/Manuals Printable datasheet for anti-NLRP1 (ARP54478_P050) antibody
Sample Type Confirmation

NLRP1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Target Reference Fahy,R.J., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 983-988
Gene Symbol NLRP1
Official Gene Full Name NLR family, pyrin domain containing 1
Alias Symbols CARD7, CLR17.1, DEFCAP, DEFCAP-L/S, DKFZp586O1822, KIAA0926, NAC, NALP1, PP1044, SLEV1, VAMAS1
NCBI Gene Id 22861
Protein Name NACHT, LRR and PYD domains-containing protein 1
Description of Target This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like
Swissprot Id Q9C000
Protein Accession # NP_001028225
Nucleotide Accession # NM_001033053
Protein Size (# AA) 1375
Molecular Weight 155kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NLRP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NLRP1.
Protein Interactions TRIM68; CUL3; APOA1; NLRP1; PYCARD; NOD1; CASP5; CASP9; APAF1; CASP2; BCL2L1; BCL2; CASP1; NLRC4;
Write Your Own Review
You're reviewing:NLRP1 Antibody - N-terminal region (ARP54478_P050)
Your Rating