Search Antibody, Protein, and ELISA Kit Solutions

NLRP1 Antibody - N-terminal region (ARP54478_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54478_P050-FITC Conjugated

ARP54478_P050-HRP Conjugated

ARP54478_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
NLR family, pyrin domain containing 1
NCBI Gene Id:
Protein Name:
NACHT, LRR and PYD domains-containing protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-116236 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NLRP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NLRP1.
The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 86%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 85%; Rat: 100%
Complete computational species homology data:
Anti-NLRP1 (ARP54478_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NLRP1 (ARP54478_P050) antibody is Catalog # AAP54478 (Previous Catalog # AAPP31258)
Printable datasheet for anti-NLRP1 (ARP54478_P050) antibody
Sample Type Confirmation:

NLRP1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Target Reference:
Fahy,R.J., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 983-988

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...