NLRP1 Antibody - N-terminal region (ARP54478_P050)

• Product Number: ARP54478_P050
• Name: NLRP1 Antibody - N-terminal region (ARP54478_P050)
• Protein Size (# AA): 1375 amino acids
• Molecular Weight: 165 kDa
• NCBI Gene Id: 22861
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: NLR family, pyrin domain containing 1
• Alias Symbols: NAC, JRRP, MSPC, AIADK, CARD7, CIDED, NALP1, SLEV1, DEFCAP, PP1044, VAMAS1, CLR17.1, DEFCAP-L/S
• Peptide Sequence: Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fahy,R.J., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 983-988
• Description of Target: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like
• Protein Interactions: TRIM68; CUL3; APOA1; NLRP1; PYCARD; NOD1; CASP5; CASP9; APAF1; CASP2; BCL2L1; BCL2; CASP1; NLRC4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-NLRP1 (ARP54478_P050) antibody is Catalog # AAP54478 (Previous Catalog # AAPP31258)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1
• Uniprot ID: Q9C000
• Protein Name: NACHT, LRR and PYD domains-containing protein 1
• Sample Type Confirmation:

  NLRP1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

• Protein Accession #: NP_001028225
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001033053
• Tested Species Reactivity: Human
• Gene Symbol: NLRP1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 86%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 85%; Rat: 100%
• Image 1: Human MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: NLRP1
  Sample Tissue: Human MCF7 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human NCI-H226
  
  WB Suggested Anti-NLRP1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: NCI-H226 cell lysate.NLRP1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226