Search Antibody, Protein, and ELISA Kit Solutions

MYL12A Antibody - N-terminal region (ARP78814_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MYL12A
Official Gene Full Name:
myosin light chain 12A
NCBI Gene Id:
10627
Protein Name:
myosin regulatory light chain 12A
Swissprot Id:
P19105
Protein Accession #:
NP_001289976.1
Nucleotide Accession #:
NM_001303047.1
Alias Symbols:
MLCB, MRCL3, MRLC3, MYL2B, MLC-2B, HEL-S-24
Description of Target:
This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.
Protein Size (# AA):
171
Molecular Weight:
18 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYL12A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYL12A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MYL12A
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MYL12A (ARP78814_P050) antibody is Catalog # AAP78814
Datasheets/Manuals:
Printable datasheet for anti-MYL12A (ARP78814_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...