| Sku |
AAP78814 |
| Price |
99 |
| Name |
MYL12A Peptide - N-terminal region (AAP78814) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MYL12A |
| Alias symbols |
MLCB, MRCL3, MRLC3, MYL2B, MLC-2B, HEL-S-24 |
| Gene id |
10627 |
| Description of target |
This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. |
| Swissprot id |
P19105 |
| Protein accession num |
NP_001289976.1 |
| Nucleotide accession num |
NM_001303047.1 |
| Protein size |
171 amino acids |
| Molecular weight |
18 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDK |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- MYL12A Antibody (ARP78814_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
