Loading...
Catalog No: P100992_P050
Price: $0.00
SKU
P100992_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MNAT1 (P100992_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MNAT1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT
Concentration0.5 mg/ml
Blocking PeptideFor anti-MNAT1 (P100992_P050) antibody is Catalog # AAP31339 (Previous Catalog # AAPP02090)
Sample Type Confirmation

MNAT1 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceLi,Y., (2007) Lung Cancer 58 (2), 171-183
Description
Gene SymbolMNAT1
Gene Full NameMenage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
Alias SymbolsMAT1, TFB3, CAP35, RNF66
NCBI Gene Id4331
Protein NameCDK-activating kinase assembly factor MAT1
Description of TargetThe coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-498 AA053721.1 1-498 499-1372 BC000820.1 489-1362 1373-1388 BU620200.1 1-16 c
Uniprot IDP51948
Protein Accession #NP_002422
Nucleotide Accession #NM_002431
Protein Size (# AA)309
Molecular Weight36kDa
Protein InteractionsRPA3; RPA2; RPA1; CDK7; CDK2; MBP; CTD; CCNH; NGFRAP1; UBC; NKX3-1; USP2; SUPT5H; POLR2A; GTF2H4; GTF2H3; GTF2H1; ERCC2; tat; TRIM39; TRIM34; TRIM17; TRIM2; ICK; TRIM31; RNF41; RNF7; TRIM26; MKRN3; TRIM21; MDM4; BRCA1; TRIML1; RNF32; TRIM9; TRIM5; XBP1P1;
  1. What is the species homology for "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish".

  2. How long will it take to receive "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MNAT1 Antibody - N-terminal region (P100992_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    This target may also be called "MAT1, TFB3, CAP35, RNF66" in publications.

  5. What is the shipping cost for "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MNAT1 Antibody - N-terminal region (P100992_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MNAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MNAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MNAT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MNAT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MNAT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MNAT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MNAT1 Antibody - N-terminal region (P100992_P050)
Your Rating