MNAT1 Antibody - N-terminal region : Biotin (P100992_P050-Biotin)

Catalog No: P100992_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MNAT1
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MNAT1 (P100992_P050-Biotin) antibody is Catalog # AAP31339 (Previous Catalog # AAPP02090)
• Sample Type Confirmation:

  MNAT1 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Li,Y., (2007) Lung Cancer 58 (2), 171-183

Target Info

• Gene Symbol: MNAT1
• Gene Full Name: Menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
• Alias Symbols: MAT1, TFB3, CAP35, RNF66
• NCBI Gene Id: 4331
• Protein Name: CDK-activating kinase assembly factor MAT1
• Description of Target: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-498 AA053721.1 1-498 499-1372 BC000820.1 489-1362 1373-1388 BU620200.1 1-16 c
• Uniprot ID: P51948
• Protein Accession #: NP_002422
• Nucleotide Accession #: NM_002431
• Protein Size (# AA): 309
• Molecular Weight: 36kDa
• Protein Interactions: RPA3; RPA2; RPA1; CDK7; CDK2; MBP; CTD; CCNH; NGFRAP1; UBC; NKX3-1; USP2; SUPT5H; POLR2A; GTF2H4; GTF2H3; GTF2H1; ERCC2; tat; TRIM39; TRIM34; TRIM17; TRIM2; ICK; TRIM31; RNF41; RNF7; TRIM26; MKRN3; TRIM21; MDM4; BRCA1; TRIML1; RNF32; TRIM9; TRIM5; XBP1P1;