MNAT1 Antibody - N-terminal region (P100992_P050)

Data Sheet
 
Product Number P100992_P050
Product Page www.avivasysbio.com/mnat1-antibody-n-terminal-region-p100992-p050.html
Name MNAT1 Antibody - N-terminal region (P100992_P050)
Protein Size (# AA) 309 amino acids
Molecular Weight 36kDa
NCBI Gene Id 4331
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
Description
Alias Symbols MAT1, TFB3, CAP35, RNF66
Peptide Sequence Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,Y., (2007) Lung Cancer 58 (2), 171-183
Description of Target The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-498 AA053721.1 1-498 499-1372 BC000820.1 489-1362 1373-1388 BU620200.1 1-16 c
Protein Interactions RPA3; RPA2; RPA1; CDK7; CDK2; MBP; CTD; CCNH; NGFRAP1; UBC; NKX3-1; USP2; SUPT5H; POLR2A; GTF2H4; GTF2H3; GTF2H1; ERCC2; tat; TRIM39; TRIM34; TRIM17; TRIM2; ICK; TRIM31; RNF41; RNF7; TRIM26; MKRN3; TRIM21; MDM4; BRCA1; TRIML1; RNF32; TRIM9; TRIM5; XBP1P1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MNAT1 (P100992_P050) antibody
Blocking Peptide For anti-MNAT1 (P100992_P050) antibody is Catalog # AAP31339 (Previous Catalog # AAPP02090)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MNAT1
Uniprot ID P51948
Protein Name CDK-activating kinase assembly factor MAT1
Sample Type Confirmation

MNAT1 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_002422
Purification Affinity Purified
Nucleotide Accession # NM_002431
Tested Species Reactivity Human
Gene Symbol MNAT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human 721_B
WB Suggested Anti-MNAT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysateMNAT1 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com