Search Antibody, Protein, and ELISA Kit Solutions

MLF1 Antibody - N-terminal region (ARP53757_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53757_P050-FITC Conjugated

ARP53757_P050-HRP Conjugated

ARP53757_P050-Biotin Conjugated

Gene Symbol:
MLF1
Official Gene Full Name:
Myeloid leukemia factor 1
NCBI Gene Id:
4291
Protein Name:
Myeloid leukemia factor 1
Swissprot Id:
P58340
Protein Accession #:
NP_071888
Nucleotide Accession #:
NM_022443
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-134895 from Santa Cruz Biotechnology.
Description of Target:
MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
Protein Size (# AA):
268
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MLF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MLF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MLF1
Predicted Species Reactivity:
Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 79%; Rabbit: 90%; Rat: 79%
Complete computational species homology data:
Anti-MLF1 (ARP53757_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CENPU; COPS3; UBC; NRBP1; YWHAZ; GRIK5; MAGEA11;
Blocking Peptide:
For anti-MLF1 (ARP53757_P050) antibody is Catalog # AAP53757 (Previous Catalog # AAPP30595)
Datasheets/Manuals:
Printable datasheet for anti-MLF1 (ARP53757_P050) antibody
Target Reference:
Li,Z.F., J. Neurol. Sci. 264 (1-2), 77-86 (2008)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...