MLF1 Antibody - N-terminal region (ARP53757_P050)

Data Sheet
 
Product Number ARP53757_P050
Product Page www.avivasysbio.com/mlf1-antibody-n-terminal-region-arp53757-p050.html
Name MLF1 Antibody - N-terminal region (ARP53757_P050)
Protein Size (# AA) 268 amino acids
Molecular Weight 29kDa
NCBI Gene Id 4291
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myeloid leukemia factor 1
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,Z.F., J. Neurol. Sci. 264 (1-2), 77-86 (2008)
Description of Target MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
Protein Interactions CENPU; COPS3; UBC; NRBP1; YWHAZ; GRIK5; MAGEA11;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MLF1 (ARP53757_P050) antibody
Blocking Peptide For anti-MLF1 (ARP53757_P050) antibody is Catalog # AAP53757 (Previous Catalog # AAPP30595)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MLF1
Uniprot ID P58340
Protein Name Myeloid leukemia factor 1
Protein Accession # NP_071888
Purification Affinity Purified
Nucleotide Accession # NM_022443
Tested Species Reactivity Human
Gene Symbol MLF1
Predicted Species Reactivity Human, Mouse, Rat, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 79%; Rabbit: 90%; Rat: 79%
Image 1
Human Liver
WB Suggested Anti-MLF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com