Product Number |
ARP53757_P050 |
Product Page |
www.avivasysbio.com/mlf1-antibody-n-terminal-region-arp53757-p050.html |
Name |
MLF1 Antibody - N-terminal region (ARP53757_P050) |
Protein Size (# AA) |
268 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
4291 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Myeloid leukemia factor 1 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Li,Z.F., J. Neurol. Sci. 264 (1-2), 77-86 (2008) |
Description of Target |
MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus. |
Protein Interactions |
CENPU; COPS3; UBC; NRBP1; YWHAZ; GRIK5; MAGEA11; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MLF1 (ARP53757_P050) antibody |
Blocking Peptide |
For anti-MLF1 (ARP53757_P050) antibody is Catalog # AAP53757 (Previous Catalog # AAPP30595) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MLF1 |
Uniprot ID |
P58340 |
Protein Name |
Myeloid leukemia factor 1 |
Protein Accession # |
NP_071888 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022443 |
Tested Species Reactivity |
Human |
Gene Symbol |
MLF1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 79%; Rabbit: 90%; Rat: 79% |
Image 1 | Human Liver
| WB Suggested Anti-MLF1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver |
|
|