Search Antibody, Protein, and ELISA Kit Solutions

LMBRD1 Antibody - C-terminal region (ARP79334_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
LMBRD1
Official Gene Full Name:
LMBR1 domain containing 1
NCBI Gene Id:
55788
Protein Name:
probable lysosomal cobalamin transporter
Swissprot Id:
Q9NUN5-3
Protein Accession #:
NP_060838.3
Nucleotide Accession #:
NM_018368.3
Alias Symbols:
NESI, LMBD1, MAHCF, C6orf209
Description of Target:
This gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the hepatitis delta virus. Mutations in this gene are associated with the vitamin B12 metabolism disorder termed, homocystinuria-megaloblastic anemia complementation type F.
Protein Size (# AA):
467
Molecular Weight:
51 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LMBRD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LMBRD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human LMBRD1
Peptide Sequence:
Synthetic peptide located within the following region: FWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-LMBRD1 (ARP79334_P050) antibody is Catalog # AAP79334
Datasheets/Manuals:
Printable datasheet for anti-LMBRD1 (ARP79334_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...