| Sku |
AAP79334 |
| Price |
99 |
| Name |
LMBRD1 Peptide - C-terminal region (AAP79334) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
LMBRD1 |
| Alias symbols |
NESI, LMBD1, MAHCF, C6orf209 |
| Gene id |
55788 |
| Description of target |
This gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the hepatitis delta virus. Mutations in this gene are associated with the vitamin B12 metabolism disorder termed, homocystinuria-megaloblastic anemia complementation type F. |
| Swissprot id |
Q9NUN5-3 |
| Protein accession num |
NP_060838.3 |
| Nucleotide accession num |
NM_018368.3 |
| Protein size |
467 amino acids |
| Molecular weight |
51 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: FWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPS |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti-LMBRD1 Antibody (ARP79334_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
