LMBRD1 Antibody - C-terminal region (ARP79334_P050)

• Product Number: ARP79334_P050
• Name: LMBRD1 Antibody - C-terminal region (ARP79334_P050)
• Protein Size (# AA): 467 amino acids
• Molecular Weight: 51 kDa
• NCBI Gene Id: 55788
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: LMBR1 domain containing 1
• Alias Symbols: NESI, LMBD1, MAHCF, C6orf209
• Peptide Sequence: Synthetic peptide located within the following region: FWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the hepatitis delta virus. Mutations in this gene are associated with the vitamin B12 metabolism disorder termed, homocystinuria-megaloblastic anemia complementation type F.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LMBRD1 (ARP79334_P050) antibody is Catalog # AAP79334
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LMBRD1
• Uniprot ID: Q9NUN5-3
• Protein Name: probable lysosomal cobalamin transporter
• Protein Accession #: NP_060838.3
• Purification: Affinity purified
• Nucleotide Accession #: NM_018368.3
• Tested Species Reactivity: Human
• Gene Symbol: LMBRD1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: LMBRD1
  Sample Tissue: Human Ovary Tumor lysates
  Antibody Dilution: 1ug/ml