Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ILF3 antibody - N-terminal region (ARP38968_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP38968_P050-FITC Conjugated

ARP38968_P050-HRP Conjugated

ARP38968_P050-Biotin Conjugated

Gene Symbol:
ILF3
NCBI Gene Id:
3609
Official Gene Full Name:
Interleukin enhancer binding factor 3, 90kDa
Protein Name:
Interleukin enhancer-binding factor 3
Swissprot Id:
Q12906-2
Protein Accession #:
NP_004507
Nucleotide Accession #:
NM_004516
Alias Symbols:
CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, TCP110, MPHOSPH4, NF-AT-90
Replacement Item:
This antibody may replace item sc-102035, HPA001897
Description of Target:
Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of ILF3.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.
Protein Size (# AA):
894
Molecular Weight:
95kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ILF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ILF3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-ILF3 (ARP38968_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PLSCR1; UBC; FBXW11; RBPMS; HUWE1; MDM2; AURKA; SUMO2; SUMO3; STAU1; IVNS1ABP; LGR4; ERG; RPA3; RPA2; RPA1; EZH2; HNRNPL; SUZ12; RNF2; BMI1; EED; VHL; VEGFA; rev; FBXO6; TARDBP; CSF2; EIF2AK2; ICAM1; IGSF8; SNORD116-22; PABPC1; RNU2-4P; RNU5B-1; RNU5A-1;
Blocking Peptide:
For anti-ILF3 (ARP38968_P050) antibody is Catalog # AAP38968 (Previous Catalog # AAPY00776)
Datasheets/Manuals:
Printable datasheet for anti-ILF3 (ARP38968_P050) antibody
Sample Type Confirmation:

ILF3 is strongly supported by BioGPS gene expression data to be expressed in K562

Specificity:
The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (702aa, 76kDa), 3 (764aa, 83kDa), 4 (698aa, 76kDa) and 5 (690aa, 75kDa), 6 (706aa, 77kDa) and 7 (898aa, 96kDa) of human ILF3.
Target Reference:
Nie,Y., (2005) Mol. Cell. Biol. 25 (16), 6956-6963

Tell us what you think about this item!

Write A Review
    Please, wait...