SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38968_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP38968_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-ILF3 (ARP38968_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ILF3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ILF3 (ARP38968_P050-HRP) antibody is Catalog # AAP38968 (Previous Catalog # AAPY00776)
Sample Type Confirmation

ILF3 is strongly supported by BioGPS gene expression data to be expressed in K562

SpecificityThe immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (702aa, 76kDa), 3 (764aa, 83kDa), 4 (698aa, 76kDa) and 5 (690aa, 75kDa), 6 (706aa, 77kDa) and 7 (898aa, 96kDa) of human ILF3.
ReferenceNie,Y., (2005) Mol. Cell. Biol. 25 (16), 6956-6963
Gene SymbolILF3
Gene Full NameInterleukin enhancer binding factor 3, 90kDa
Alias SymbolsCBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90
NCBI Gene Id3609
Protein NameInterleukin enhancer-binding factor 3
Description of TargetNuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of ILF3.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.
Uniprot IDQ12906-2
Protein Accession #NP_004507
Nucleotide Accession #NM_004516
Protein Size (# AA)894
Molecular Weight95kDa
Protein InteractionsPLSCR1; UBC; FBXW11; RBPMS; HUWE1; MDM2; AURKA; SUMO2; SUMO3; STAU1; IVNS1ABP; LGR4; ERG; RPA3; RPA2; RPA1; EZH2; HNRNPL; SUZ12; RNF2; BMI1; EED; VHL; VEGFA; rev; FBXO6; TARDBP; CSF2; EIF2AK2; ICAM1; IGSF8; SNORD116-22; PABPC1; RNU2-4P; RNU5B-1; RNU5A-1;
  1. What is the species homology for "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    This target may also be called "CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90" in publications.

  5. What is the shipping cost for "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "95kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ILF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ILF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ILF3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ILF3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ILF3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ILF3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ILF3 Antibody - N-terminal region : HRP (ARP38968_P050-HRP)
Your Rating
We found other products you might like!