ILF3 antibody - N-terminal region (ARP38968_P050)
Data Sheet
Product Number ARP38968_P050
Product Page
Product Name ILF3 antibody - N-terminal region (ARP38968_P050)
Size 100 ul
Gene Symbol ILF3
Alias Symbols CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, TCP110, MPHOSPH4, NF-AT-90
Protein Size (# AA) 894 amino acids
Molecular Weight 95kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 3609
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Interleukin enhancer binding factor 3, 90kDa
Description This is a rabbit polyclonal antibody against ILF3. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG
Target Reference Nie,Y., (2005) Mol. Cell. Biol. 25 (16), 6956-6963
Description of Target Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of ILF3.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Specificity The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (702aa, 76kDa), 3 (764aa, 83kDa), 4 (698aa, 76kDa) and 5 (690aa, 75kDa), 6 (706aa, 77kDa) and 7 (898aa, 96kDa) of human ILF3.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ILF3 (ARP38968_P050) antibody is Catalog # AAP38968 (Previous Catalog # AAPY00776)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3
Complete computational species homology data Anti-ILF3 (ARP38968_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ILF3.
Swissprot Id Q12906-2
Protein Name Interleukin enhancer-binding factor 3
Sample Type Confirmation

ILF3 is strongly supported by BioGPS gene expression data to be expressed in K562

Protein Accession # NP_004507
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ILF3.
Nucleotide Accession # NM_004516
Replacement Item This antibody may replace item sc-102035, HPA001897
Conjugation Options

ARP38968_P050-FITC Conjugated

ARP38968_P050-HRP Conjugated

ARP38968_P050-Biotin Conjugated

CB Replacement sc-102035; sc-106301; sc-136197; HPA001897
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Lung
Human Lung
Image 2
rat aorta
WB Suggested Anti-ILF3 Antibody
Titration: 1 ug/ml
Positive Control: Rat tissue
Image 3
Human Pineal Tissue
Rabbit Anti-ILF3 Antibody
Catalog Number: ARP38968_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic and nuclear in pinealocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 4
Human Stomach Tumor
Host: Rabbit
Target Name: ILF3
Sample Tissue: Human Stomach Tumor
Antibody Dilution: 1.0ug/ml

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |