Search Antibody, Protein, and ELISA Kit Solutions

HNRPL Antibody - N-terminal region : FITC (ARP40368_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40368_P050 Unconjugated

ARP40368_P050-HRP Conjugated

ARP40368_P050-Biotin Conjugated

Gene Symbol:
HNRNPL
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein L
NCBI Gene Id:
3191
Protein Name:
Heterogeneous nuclear ribonucleoprotein L
Swissprot Id:
P14866
Protein Accession #:
NP_001524
Nucleotide Accession #:
NM_001533
Alias Symbols:
HNRPL, hnRNP-L, P/OKcl.14
Replacement Item:
This antibody may replace item sc-16550 from Santa Cruz Biotechnology.
Description of Target:
Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions.Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
589
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, IP, WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPL.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HNRPL (ARP40368_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TP53; FUS; TRIM68; SUMO2; SUMO3; IVNS1ABP; UBC; MDM2; RPA3; RPA2; RPA1; ILF3; HNRNPA2B1; EED; VHL; VEGFA; RNF2; NEDD4; ITCH; FBXO6; HMGA1; vif; TP63; UBL4A; WHSC1; VCAM1; ITGA4; IL7R; IFIT3; IFIT2; FN1; DAB2; CSNK2A1; EIF4A3; MAGOH; HNRNPA3; NPLOC4; LSM14
Blocking Peptide:
For anti-HNRNPL (ARP40368_P050-FITC) antibody is Catalog # AAP40368 (Previous Catalog # AAPP22112)
Datasheets/Manuals:
Printable datasheet for anti-HNRNPL (ARP40368_P050-FITC) antibody
Sample Type Confirmation:

HNRNPL is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Guang,S., (2005) Mol. Cell. Biol. 25 (15), 6303-6313

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...