Size:100 ul
$289.00
In Stock
SKU
ARP64733_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64733_P050 Unconjugated

ARP64733_P050-FITC Conjugated

ARP64733_P050-Biotin Conjugated

HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)

Catalog#: ARP64733_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-21756 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 77%; Goat: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 75%; Rat: 83%; Sheep: 100%
Complete computational species homology data Anti-HBG2 (ARP64733_P050)
Peptide Sequence Synthetic peptide located within the following region: MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK
Concentration 0.5 mg/ml
Blocking Peptide For anti-HBG2 (ARP64733_P050-HRP) antibody is Catalog # AAP64733
Datasheets/Manuals Printable datasheet for anti-HBG2 (ARP64733_P050-HRP) antibody
Subunit gamma-2
Gene Symbol HBG2
Official Gene Full Name Hemoglobin, gamma G
Alias Symbols FLJ76540
NCBI Gene Id 3048
Protein Name Hemoglobin subunit gamma-2
Description of Target The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Swissprot Id P69892
Protein Accession # NP_000175
Nucleotide Accession # NM_000184
Protein Size (# AA) 147
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HBG2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HBG2.
Protein Interactions VCAM1; SMAD5; RPSA; ITGA4; APP; CYB5R3; HBG2; HBB;
  1. What is the species homology for "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    This target may also be called "FLJ76540" in publications.

  5. What is the shipping cost for "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HBG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HBG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HBG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HBG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HBG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HBG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP)
Your Rating