Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP64733_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64733_P050-FITC Conjugated

ARP64733_P050-HRP Conjugated

ARP64733_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-21756 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 77%; Goat: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 75%; Rat: 83%; Sheep: 100%
Complete computational species homology data Anti-HBG2 (ARP64733_P050)
Peptide Sequence Synthetic peptide located within the following region: MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HBG2 (ARP64733_P050) antibody is Catalog # AAP64733
Datasheets/Manuals Printable datasheet for anti-HBG2 (ARP64733_P050) antibody
Subunit gamma-2
Gene Symbol HBG2
Official Gene Full Name Hemoglobin, gamma G
Alias Symbols FLJ76540
NCBI Gene Id 3048
Protein Name Hemoglobin subunit gamma-2
Description of Target The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Swissprot Id P69892
Protein Accession # NP_000175
Nucleotide Accession # NM_000184
Protein Size (# AA) 147
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HBG2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HBG2.
Protein Interactions VCAM1; SMAD5; RPSA; ITGA4; APP; CYB5R3; HBG2; HBB;
Write Your Own Review
You're reviewing:HBG2 Antibody - middle region (ARP64733_P050)
Your Rating