Product Number |
ARP64733_P050-HRP |
Product Page |
www.avivasysbio.com/hbg2-antibody-middle-region-hrp-arp64733-p050-hrp.html |
Name |
HBG2 Antibody - middle region : HRP (ARP64733_P050-HRP) |
Protein Size (# AA) |
147 amino acids |
Molecular Weight |
16kDa |
Subunit |
gamma-2 |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
3048 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Hemoglobin, gamma G |
Alias Symbols |
TNCY, HBG-T1 |
Peptide Sequence |
Synthetic peptide located within the following region: MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Description of Target |
The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. |
Protein Interactions |
VCAM1; SMAD5; RPSA; ITGA4; APP; CYB5R3; HBG2; HBB; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-HBG2 (ARP64733_P050-HRP) antibody |
Blocking Peptide |
For anti-HBG2 (ARP64733_P050-HRP) antibody is Catalog # AAP64733 |
Uniprot ID |
P69892 |
Protein Name |
Hemoglobin subunit gamma-2 |
Protein Accession # |
NP_000175 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000184 |
Gene Symbol |
HBG2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 77%; Goat: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 75%; Rat: 83%; Sheep: 100% |
Image 1 | |
|