Search Antibody, Protein, and ELISA Kit Solutions

HAL Antibody - C-terminal region (ARP45694_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45694_T100-FITC Conjugated

ARP45694_T100-HRP Conjugated

ARP45694_T100-Biotin Conjugated

Gene Symbol:
HAL
Official Gene Full Name:
Histidine ammonia-lyase
NCBI Gene Id:
3034
Protein Name:
Histidine ammonia-lyase
Swissprot Id:
P42357
Protein Accession #:
NP_002099
Nucleotide Accession #:
NM_002108
Alias Symbols:
HIS, HSTD
Replacement Item:
This antibody may replace item sc-133646 from Santa Cruz Biotechnology.
Description of Target:
HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluidsHistidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.
Protein Size (# AA):
657
Molecular Weight:
72kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HAL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HAL.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HAL
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-HAL (ARP45694_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-HAL (ARP45694_T100) antibody is Catalog # AAP45694 (Previous Catalog # AAPP11827)
Datasheets/Manuals:
Printable datasheet for anti-HAL (ARP45694_T100) antibody
Additional Information:
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Aleman,G., Am. J. Physiol. Endocrinol. Metab. 289 (1), E172-E179 (2005)
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...