HAL Antibody - C-terminal region : HRP (ARP45694_T100-HRP)

Catalog No: ARP45694_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Additional Information: IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAL
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HAL (ARP45694_T100-HRP) antibody is Catalog # AAP45694 (Previous Catalog # AAPP11827)
• Reference: Aleman,G., Am. J. Physiol. Endocrinol. Metab. 289 (1), E172-E179 (2005)
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Mouse, Human, Rat, Bovine, Dog, Pig, Horse, Rabbit, Guinea pig, Zebrafish 24465277

Target Info

• Gene Symbol: HAL
• Gene Full Name: Histidine ammonia-lyase
• Alias Symbols: HIS, HSTD
• NCBI Gene Id: 3034
• Protein Name: Histidine ammonia-lyase
• Description of Target: HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluidsHistidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.
• Uniprot ID: P42357
• Protein Accession #: NP_002099
• Nucleotide Accession #: NM_002108
• Protein Size (# AA): 657
• Molecular Weight: 72kDa
• Protein Interactions: UBC;