| Product Number |
ARP45694_T100 |
| Product Page |
www.avivasysbio.com/hal-antibody-c-terminal-region-arp45694-t100.html |
| Name |
HAL Antibody - C-terminal region (ARP45694_T100) |
| Protein Size (# AA) |
657 amino acids |
| Molecular Weight |
72kDa |
| NCBI Gene Id |
3034 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Histidine ammonia-lyase |
| Alias Symbols |
HIS, HSTD |
| Peptide Sequence |
Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Aleman,G., Am. J. Physiol. Endocrinol. Metab. 289 (1), E172-E179 (2005) |
| Description of Target |
HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluidsHistidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HAL (ARP45694_T100) antibody |
| Additional Information |
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-HAL (ARP45694_T100) antibody is Catalog # AAP45694 (Previous Catalog # AAPP11827) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HAL |
| Uniprot ID |
P42357 |
| Protein Name |
Histidine ammonia-lyase |
| Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277 |
| Protein Accession # |
NP_002099 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002108 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HAL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human Muscle
 | Human Muscle |
|
| Image 2 | Human Fetal liver
 | WB Suggested Anti-HAL Antibody Titration: 1.25 ug/ml
Positive Control: Fetal liver cell lysate |
|
