GZMA Recombinant Protein (Mouse) (OPCA05093)

Catalog No: OPCA05093

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Mus musculus (Mouse)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
• Protein Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 29-260 aa
• Tag: N-terminal 6xHis-B2M-tagged
• Reference: Genomic organization of the mouse granzyme A gene. Two mRNAs encode the same mature granzyme A with different leader peptides. Hershberger R.J., Gershenfeld H.K., Weissman I.L., Su L. J. Biol. Chem. 267:25488-25493(1992)

Target Info

• Gene Symbol: Gzma
• Gene Full Name: granzyme A
• Alias Symbols: autocrine thymic lymphoma granzyme-like serine protease;AW494114;BLT esterase;Ctl;Ctla;Ctla3;Ctla-3;fragmentin-1;granzyme A;H factor;Hanukah factor;Hf;Hf1;SE;SE1;serine esterase 1;t cell-specific serine protease 1;TS;TSP;TSP1;TSP-1.
• NCBI Gene Id: 14938
• Protein Name: Granzyme A
• Description of Target: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity).
• Uniprot ID: P11032
• Protein Accession #: NP_034500
• Nucleotide Accession #: NM_010370
• Protein Size (# AA): Recombinant
• Molecular Weight: 39.6 kDa