GZMA Antibody - middle region (ARP54793_P050)

Catalog No: ARP54793_P050

Host: Rabbit
Target Name: GZMA
Sample Type: HEK293T
Antibody Dilution: 0.2 ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GZMA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GZMA (ARP54793_P050) antibody is Catalog # AAP54793 (Previous Catalog # AAPP31588)
• Sample Type Confirmation:

  GZMA is supported by BioGPS gene expression data to be expressed in Jurkat

Target Info

• Reference: Bem,R.A., (2008) Pediatr. Res. 63 (6), 650-655
• Gene Symbol: GZMA
• Gene Full Name: Granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
• Alias Symbols: HFSP, CTLA3
• NCBI Gene Id: 3001
• Protein Name: Granzyme A
• Description of Target: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P12544
• Protein Accession #: NP_006135
• Nucleotide Accession #: NM_006144
• Protein Size (# AA): 262
• Molecular Weight: 29kDa
• Protein Interactions: HSP90AA1; HSPA4; HMGB2; APEX1; XRCC5; XRCC6; HIST2H2BE; SET; LMNA; HNRNPK; HDC; HIST1H1A; GZMA; GOLGA2; ACTG1; Ndufs3; NCL; LMNB1;