Catalog No: ARP58007_P050
Price: $0.00
SKU
ARP58007_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GTF2I (ARP58007_P050) antibody
Product Info
ReferenceEwing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GTF2I
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: INNQLVDQSESEGPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW
Concentration0.5 mg/ml
Blocking PeptideFor anti-GTF2I (ARP58007_P050) antibody is Catalog # AAP58007 (Previous Catalog # AAPP32430)
Sample Type Confirmation

There is BioGPS gene expression data showing that GTF2I is expressed in HEK293T

Gene SymbolGTF2I
Gene Full NameGeneral transcription factor IIi
Alias SymbolsWBS, DIWS, SPIN, IB291, BAP135, BTKAP1, TFII-I, WBSCR6, GTFII-I
NCBI Gene Id2969
Protein NameGeneral transcription factor II-I
Description of TargetGTF2I is a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23.This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5' UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its alternative splicing generates 4 transcript variants. This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Four transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP78347
Protein Accession #NP_127492
Nucleotide Accession #NM_032999
Protein Size (# AA)998
Molecular Weight112kDa
Protein InteractionsTP53; ZMYM3; PIAS2; TUBG1; TRAF6; SUMO2; SUMO3; AP2B1; DPY30; GCC1; MTUS2; MDM2; UBC; SUMO1; RPA3; RPA2; RPA1; EED; RNF2; SUZ12; CTPS2; WARS; RPL28; RAD23B; PRPS2; PRKDC; NUCB1; METTL1; ADSL; FBXO6; UBD; CBX2; TAB2; AP4S1; CBX4; MAPK12; C4BPA; MAP3K3; SLU
  1. What is the species homology for "GTF2I Antibody - middle region (ARP58007_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GTF2I Antibody - middle region (ARP58007_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GTF2I Antibody - middle region (ARP58007_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GTF2I Antibody - middle region (ARP58007_P050)"?

    This target may also be called "WBS, DIWS, SPIN, IB291, BAP135, BTKAP1, TFII-I, WBSCR6, GTFII-I" in publications.

  5. What is the shipping cost for "GTF2I Antibody - middle region (ARP58007_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GTF2I Antibody - middle region (ARP58007_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GTF2I Antibody - middle region (ARP58007_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "112kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GTF2I Antibody - middle region (ARP58007_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GTF2I"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GTF2I"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GTF2I"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GTF2I"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GTF2I"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GTF2I"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GTF2I Antibody - middle region (ARP58007_P050)
Your Rating
We found other products you might like!