Size:100 ul
$249.00
In Stock
SKU
ARP32368_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32368_T100-FITC Conjugated

ARP32368_T100-HRP Conjugated

ARP32368_T100-Biotin Conjugated

GLI1 Antibody - C-terminal region (ARP32368_T100)

Catalog#: ARP32368_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20687 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GLI1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-GLI1 (ARP32368_T100)
Peptide Sequence Synthetic peptide located within the following region: TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GLI1 (ARP32368_T100) antibody is Catalog # AAP32368 (Previous Catalog # AAPP03357)
Datasheets/Manuals Printable datasheet for anti-GLI1 (ARP32368_T100) antibody
Target Reference Rahnama,F., et al., (2006) Biochem. J. 394 (PT 1), 19-26
Publications

Bosco-Clément, G. et al. Targeting Gli transcription activation by small molecule suppresses tumor growth. Oncogene 33, 2087-97 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23686308

Ferruzzi, P. et al. In vitro and in vivo characterization of a novel Hedgehog signaling antagonist in human glioblastoma cell lines. Int. J. Cancer 131, E33-44 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22072503

Iwata, J. et al. Modulation of lipid metabolic defects rescues cleft palate in Tgfbr2 mutant mice. Hum. Mol. Genet. 23, 182-93 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23975680

Maitah, M. Y., Ali, S., Ahmad, A., Gadgeel, S. & Sarkar, F. H. Up-regulation of sonic hedgehog contributes to TGF-b1-induced epithelial to mesenchymal transition in NSCLC cells. PLoS One 6, e16068 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21249152

Ortega, M. C. et al. Megalin mediates the influence of sonic hedgehog on oligodendrocyte precursor cell migration and proliferation during development. Glia 60, 851-66 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22354480

Pandolfi, S. et al. WIP1 phosphatase modulates the Hedgehog signaling by enhancing GLI1 function. Oncogene 32, 4737-47 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23146903

Schiapparelli, P. et al. Inhibition of the sonic hedgehog pathway by cyplopamine reduces the CD133+/CD15+ cell compartment and the in vitro tumorigenic capability of neuroblastoma cells. Cancer Lett. 310, 222-31 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21803487

Yoshimura, K., Kawate, T. & Takeda, S. Signaling through the primary cilium affects glial cell survival under a stressed environment. Glia 59, 333-44 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21125655

Gene Symbol GLI1
Official Gene Full Name GLI family zinc finger 1
Alias Symbols GLI
NCBI Gene Id 2735
Protein Name Zinc finger protein GLI1
Description of Target GLI1 is a protein which is a member of the Kruppel family of zinc finger proteins. The function of this gene has not been determined; however, it may play a role in normal development gene transcription. Mouse mutation studies indicate possible involvement in human foregut malformation.
Swissprot Id P08151
Protein Accession # NP_005260
Nucleotide Accession # NM_005269
Protein Size (# AA) 1106
Molecular Weight 118kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GLI1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GLI1.
Protein Interactions TRIM42; GCC1; PRKAA2; VHL; FEM1B; CDK4; UBC; MYC; ITCH; NUMB; SUFU; RAI1; XBP1; HDAC2; HDAC1; STK36; DYRK1A; ZIC2; ZIC1; Sin3a; Shh; SAP18; Su(fu); Pias1;
  1. What is the species homology for "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GLI1 Antibody - C-terminal region (ARP32368_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    This target may also be called "GLI" in publications.

  5. What is the shipping cost for "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "118kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GLI1 Antibody - C-terminal region (ARP32368_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GLI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GLI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GLI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GLI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GLI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GLI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GLI1 Antibody - C-terminal region (ARP32368_T100)
Your Rating
We found other products you might like!