- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-FOXP1 (ARP32564_T100-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1 |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-FOXP1 (ARP32564_T100-FITC) antibody is Catalog # AAP32564 (Previous Catalog # AAPP03567) |
Reference | Shi,C., et al., (2004) J. Clin. Invest. 114 (3), 408-418 |
Publications | Jepsen, K., Gleiberman, A. S., Shi, C., Simon, D. I. & Rosenfeld, M. G. Cooperative regulation in development by SMRT and FOXP1. Genes Dev. 22, 740-5 (2008). ChIP, Human, Mouse, Horse, Rabbit, Guinea pig, Rat, Bovine, Dog 18347093 Konstantoulas, C. J., Parmar, M. & Li, M. FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3. J. Neurochem. 113, 836-47 (2010). ChIP, Human, Mouse, Horse, Rabbit, Guinea pig, Rat, Bovine, Dog 20175877 Tang, B. et al. Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease. Hum. Mol. Genet. 21, 3097-111 (2012). ChIP, Human, Mouse, Horse, Rabbit, Guinea pig, Rat, Bovine, Dog 22492998 |
Gene Symbol | FOXP1 |
---|---|
Gene Full Name | Forkhead box P1 |
Alias Symbols | MFH, QRF1, 12CC4, hFKH1B, HSPC215 |
NCBI Gene Id | 27086 |
Protein Name | Forkhead box protein P1 |
Description of Target | FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). |
Uniprot ID | Q9H334 |
Protein Accession # | NP_116071 |
Nucleotide Accession # | NM_032682 |
Protein Size (# AA) | 677 |
Molecular Weight | 75kDa |
Protein Interactions | SUMO2; MYC; IL3RA; ELAVL1; NCOR2; GATAD2B; MTA1; FOXP1; FOXP4; FOXP2; CTBP1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
This target may also be called "MFH, QRF1, 12CC4, hFKH1B, HSPC215" in publications.
-
What is the shipping cost for "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "75kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FOXP1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FOXP1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FOXP1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FOXP1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FOXP1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FOXP1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.