Size:100 ul
$229.00
In Stock
SKU
ARP32564_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32564_T100-FITC Conjugated

ARP32564_T100-HRP Conjugated

ARP32564_T100-Biotin Conjugated

FOXP1 Antibody - N-terminal region (ARP32564_T100)

Catalog#: ARP32564_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-31731 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-FOXP1 (ARP32564_T100)
Peptide Sequence Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXP1 (ARP32564_T100) antibody is Catalog # AAP32564 (Previous Catalog # AAPP03567)
Datasheets/Manuals Printable datasheet for anti-FOXP1 (ARP32564_T100) antibody
Target Reference Shi,C., et al., (2004) J. Clin. Invest. 114 (3), 408-418
Publications

Jepsen, K., Gleiberman, A. S., Shi, C., Simon, D. I. & Rosenfeld, M. G. Cooperative regulation in development by SMRT and FOXP1. Genes Dev. 22, 740-5 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18347093

Konstantoulas, C. J., Parmar, M. & Li, M. FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3. J. Neurochem. 113, 836-47 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20175877

Tang, B. et al. Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease. Hum. Mol. Genet. 21, 3097-111 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22492998

Gene Symbol FOXP1
Official Gene Full Name Forkhead box P1
Alias Symbols QRF1, 12CC4, hFKH1B, HSPC215
NCBI Gene Id 27086
Protein Name Forkhead box protein P1
Description of Target FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
Swissprot Id Q9H334
Protein Accession # NP_116071
Nucleotide Accession # NM_032682
Protein Size (# AA) 677
Molecular Weight 75kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXP1.
Protein Interactions SUMO2; MYC; IL3RA; ELAVL1; NCOR2; GATAD2B; MTA1; FOXP1; FOXP4; FOXP2; CTBP1;
  1. What is the species homology for "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXP1 Antibody - N-terminal region (ARP32564_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    This target may also be called "QRF1, 12CC4, hFKH1B, HSPC215" in publications.

  5. What is the shipping cost for "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "75kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXP1 Antibody - N-terminal region (ARP32564_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXP1 Antibody - N-terminal region (ARP32564_T100)
Your Rating
We found other products you might like!