Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

FOXP1 Antibody - N-terminal region (ARP32564_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32564_T100-FITC Conjugated

ARP32564_T100-HRP Conjugated

ARP32564_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Forkhead box P1
NCBI Gene Id:
Protein Name:
Forkhead box protein P1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
QRF1, 12CC4, hFKH1B, HSPC215
Replacement Item:
This antibody may replace item sc-31731 from Santa Cruz Biotechnology.
Description of Target:
FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXP1.
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-FOXP1 (ARP32564_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXP1 (ARP32564_T100) antibody is Catalog # AAP32564 (Previous Catalog # AAPP03567)
Printable datasheet for anti-FOXP1 (ARP32564_T100) antibody
Target Reference:
Shi,C., et al., (2004) J. Clin. Invest. 114 (3), 408-418

Jepsen, K., Gleiberman, A. S., Shi, C., Simon, D. I. & Rosenfeld, M. G. Cooperative regulation in development by SMRT and FOXP1. Genes Dev. 22, 740-5 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18347093

Konstantoulas, C. J., Parmar, M. & Li, M. FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3. J. Neurochem. 113, 836-47 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20175877

Tang, B. et al. Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease. Hum. Mol. Genet. 21, 3097-111 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22492998

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...