Search Antibody, Protein, and ELISA Kit Solutions

FOXO1A Antibody - N-terminal region (ARP38094_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38094_T100-FITC Conjugated

ARP38094_T100-HRP Conjugated

ARP38094_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Forkhead box O1
NCBI Gene Id:
Protein Name:
Forkhead box protein O1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-11350 from Santa Cruz Biotechnology.
Description of Target:
FOXO1A belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of FOXO1A has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of FOXO1A gene with PAX3 has been associated with alveolar rhabdomyosarcoma.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXO1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXO1A.
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXO1A
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rat: 85%; Yeast: 85%
Complete computational species homology data:
Anti-FOXO1A (ARP38094_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXO1 (ARP38094_T100) antibody is Catalog # AAP38094 (Previous Catalog # AAPP20268)
Printable datasheet for anti-FOXO1 (ARP38094_T100) antibody
Target Reference:
Okamoto,H., et al., (2006) J. Clin. Invest. 116 (3), 775-782

Hsu, C.-Y. & Hu, T.-H. Energy-regulated molecules maintain young status in the trophocytes and fat cells of old queen honeybees. Biogerontology 15, 389-400 (2014). WB, Cow, Dog, Human, Mouse, Pig, Rat, Yeast 24973265

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...