Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

FOXO1A Antibody - N-terminal region (ARP38094_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38094_T100-FITC Conjugated

ARP38094_T100-HRP Conjugated

ARP38094_T100-Biotin Conjugated

Gene Symbol:
FOXO1
Official Gene Full Name:
Forkhead box O1
NCBI Gene Id:
2308
Protein Name:
Forkhead box protein O1
Swissprot Id:
Q12778
Protein Accession #:
NP_002006
Nucleotide Accession #:
NM_002015
Alias Symbols:
FKH1, FKHR, FOXO1A
Replacement Item:
This antibody may replace item sc-11350 from Santa Cruz Biotechnology.
Description of Target:
FOXO1A belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of FOXO1A has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of FOXO1A gene with PAX3 has been associated with alveolar rhabdomyosarcoma.
Protein Size (# AA):
655
Molecular Weight:
70kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXO1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXO1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXO1A
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat, Yeast
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rat: 85%; Yeast: 85%
Complete computational species homology data:
Anti-FOXO1A (ARP38094_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EP300; AKT1; MST1; SIRT1; FHL2; ATG7; IRF3; FSHR; ESR1; Ubc; TXNRD1; RARA; MDM2; NLK; SKP2; SIRT2; STUB1; CREBBP; PML; LRPPRC; HOXA11; HNF4A; PARP1; DYRK1A; THRB; CSNK1G1; YWHAG; GSK3B; SMAD3; PAK1; PPARG; YWHAZ; SMAD4; AR; G6PC; SRC; CEBPB; FOXG1; HOXA10
Blocking Peptide:
For anti-FOXO1 (ARP38094_T100) antibody is Catalog # AAP38094 (Previous Catalog # AAPP20268)
Datasheets/Manuals:
Printable datasheet for anti-FOXO1 (ARP38094_T100) antibody
Target Reference:
Okamoto,H., et al., (2006) J. Clin. Invest. 116 (3), 775-782
Publications:

Hsu, C.-Y. & Hu, T.-H. Energy-regulated molecules maintain young status in the trophocytes and fat cells of old queen honeybees. Biogerontology 15, 389-400 (2014). WB, Cow, Dog, Human, Mouse, Pig, Rat, Yeast 24973265

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...