Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38094_T100-FITC Conjugated

ARP38094_T100-HRP Conjugated

ARP38094_T100-Biotin Conjugated

FOXO1A Antibody - N-terminal region (ARP38094_T100)

Catalog#: ARP38094_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Mouse, Pig, Rat, Yeast
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11350 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXO1A
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rat: 85%; Yeast: 85%
Complete computational species homology data Anti-FOXO1A (ARP38094_T100)
Peptide Sequence Synthetic peptide located within the following region: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXO1 (ARP38094_T100) antibody is Catalog # AAP38094 (Previous Catalog # AAPP20268)
Datasheets/Manuals Printable datasheet for anti-FOXO1 (ARP38094_T100) antibody
Target Reference Okamoto,H., et al., (2006) J. Clin. Invest. 116 (3), 775-782

Hsu, C.-Y. & Hu, T.-H. Energy-regulated molecules maintain young status in the trophocytes and fat cells of old queen honeybees. Biogerontology 15, 389-400 (2014). WB, Cow, Dog, Human, Mouse, Pig, Rat, Yeast 24973265

Gene Symbol FOXO1
Official Gene Full Name Forkhead box O1
Alias Symbols FKH1, FKHR, FOXO1A
NCBI Gene Id 2308
Protein Name Forkhead box protein O1
Description of Target FOXO1A belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of FOXO1A has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of FOXO1A gene with PAX3 has been associated with alveolar rhabdomyosarcoma.
Swissprot Id Q12778
Protein Accession # NP_002006
Nucleotide Accession # NM_002015
Protein Size (# AA) 655
Molecular Weight 70kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXO1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXO1A.
  1. What is the species homology for "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Pig, Rat, Yeast".

  2. How long will it take to receive "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXO1A Antibody - N-terminal region (ARP38094_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    This target may also be called "FKH1, FKHR, FOXO1A" in publications.

  5. What is the shipping cost for "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXO1A Antibody - N-terminal region (ARP38094_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXO1A Antibody - N-terminal region (ARP38094_T100)
Your Rating
We found other products you might like!