Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38094_T100-FITC Conjugated

ARP38094_T100-HRP Conjugated

ARP38094_T100-Biotin Conjugated

FOXO1A Antibody - N-terminal region (ARP38094_T100)

Catalog#: ARP38094_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Human, Mouse, Pig, Rat, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-11350 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FOXO1A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rat: 85%; Yeast: 85%
Complete computational species homology dataAnti-FOXO1A (ARP38094_T100)
Peptide SequenceSynthetic peptide located within the following region: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FOXO1 (ARP38094_T100) antibody is Catalog # AAP38094 (Previous Catalog # AAPP20268)
Datasheets/ManualsPrintable datasheet for anti-FOXO1 (ARP38094_T100) antibody
Target ReferenceOkamoto,H., et al., (2006) J. Clin. Invest. 116 (3), 775-782

Hsu, C.-Y. & Hu, T.-H. Energy-regulated molecules maintain young status in the trophocytes and fat cells of old queen honeybees. Biogerontology 15, 389-400 (2014). WB, Cow, Dog, Human, Mouse, Pig, Rat, Yeast 24973265

Gene SymbolFOXO1
Official Gene Full NameForkhead box O1
Alias SymbolsFKH1, FKHR, FOXO1A
NCBI Gene Id2308
Protein NameForkhead box protein O1
Description of TargetFOXO1A belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of FOXO1A has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of FOXO1A gene with PAX3 has been associated with alveolar rhabdomyosarcoma.
Swissprot IdQ12778
Protein Accession #NP_002006
Nucleotide Accession #NM_002015
Protein Size (# AA)655
Molecular Weight70kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FOXO1A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FOXO1A.
Write Your Own Review
You're reviewing:FOXO1A Antibody - N-terminal region (ARP38094_T100)
Your Rating
Aviva Blast Tool
Aviva HIS tag Deal
Aviva Travel Grant
Aviva Live Chat