Size:100 ug
$299.00
In Stock
SKU
OAAF07382
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07382-FITC Conjugated

OAAF07382-HRP Conjugated

OAAF07382-Biotin Conjugated

FOXO1A Antibody (Phospho-Ser329) (OAAF07382)

Catalog#: OAAF07382
Domestic: within 1 week delivery | International: 1 week
This product is Genway GWB-ASB152
More Information
Predicted Species Reactivity Human, Mouse, Rat
Product Format Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
Clonality Polyclonal
Isotype IgG
Host Rabbit
Application WB, IHC
Additional Information Modification Sites: Human:S329 Mouse:S326 Rat:S323
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-11350, HPA001252
Immunogen The antiserum was produced against synthesized peptide derived between 295-344 amino acids from human FOXO1A around the phosphorylation site of Ser329.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide Sequence Synthetic peptide located within the following region: WPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVH
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF07382
Specificity FOXO1A (Phospho-Ser329) Antibody detects endogenous levels of FOXO1A only when phosphorylated at Ser329.
Application Info WB: 1:500~1000
IHC: 1:50~100
ELISA: 1:1000
Gene Symbol FOXO1
Alias Symbols FKHR, forkhead box O1A (FKHR), Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1
NCBI Gene Id 2308
Swissprot Id Q12778
Molecular Weight 69 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXO1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXO1.
  1. What is the species homology for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)" provided in?

    This item is provided in "Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    This target may also be called "FKHR, forkhead box O1A (FKHR), Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1" in publications.

  5. What is the shipping cost for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXO1A Antibody (Phospho-Ser329) (OAAF07382)
Your Rating
We found other products you might like!