Search Antibody, Protein, and ELISA Kit Solutions

FOXO1A Antibody (Phospho-Ser329) (OAAF07382)

100 ug
$299.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF07382-FITC Conjugated

OAAF07382-HRP Conjugated

OAAF07382-Biotin Conjugated

Predicted Species Reactivity:
Human, Mouse, Rat
Product Format:
Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
Clonality:
Polyclonal
Isotype:
IgG
Host:
Rabbit
Application:
WB, IHC
Additional Information:
Modification Sites: Human:S329 Mouse:S326 Rat:S323
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Gene Symbol:
FOXO1
NCBI Gene Id:
2308
Swissprot Id:
Q12778
Alias Symbols:
FKHR, forkhead box O1A (FKHR), Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1
Replacement Item:
This antibody may replace item sc-11350, HPA001252
Molecular Weight:
69 kDa
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXO1.
Immunogen:
The antiserum was produced against synthesized peptide derived between 295-344 amino acids from human FOXO1A around the phosphorylation site of Ser329.
Peptide Sequence:
Synthetic peptide located within the following region: WPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVH
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF07382
Specificity:
FOXO1A (Phospho-Ser329) Antibody detects endogenous levels of FOXO1A only when phosphorylated at Ser329.
Application Info:
WB: 1:500~1000
IHC: 1:50~100
ELISA: 1:1000

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...