- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for FOXO1A Antibody (Phospho-Ser329) (OAAF07382) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Product Format | Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Additional Information | Modification Sites: H:S329, M: S326, R: S323 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human FOXO1A around the phosphorylation site of Ser329. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: WPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVH |
Concentration | 1 mg/ml |
Specificity | FOXO1A (Phospho-Ser329) Antibody detects endogenous levels of FOXO1A only when phosphorylated at Ser329. |
Application Info | WB: 1:500~1000 IHC: 1:50~100 ELISA: 1:1000 |
Gene Symbol | FOXO1 |
---|---|
Gene Full Name | forkhead box O1 |
Alias Symbols | FKH1;FKHR;forkhead box protein O1;forkhead box protein O1A;Forkhead in rhabdomyosarcoma;forkhead, Drosophila, homolog of, in rhabdomyosarcoma;FOXO1A. |
NCBI Gene Id | 2308 |
Protein Name | Forkhead box protein O1 |
Description of Target | Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress. Binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'-TT[G/A]TTTAC-3'. Activity suppressed by insulin. Main regulator of redox balance and osteoblast numbers and controls bone mass. Orchestrates the endocrine function of the skeleton in regulating glucose metabolism. Acts synergistically with ATF4 to suppress osteocalcin/BGLAP activity, increasing glucose levels and triggering glucose intolerance and insulin insensitivity. Also suppresses the transcriptional activity of RUNX2, an upstream activator of osteocalcin/BGLAP. In hepatocytes, promotes gluconeogenesis by acting together with PPARGC1A and CEBPA to activate the expression of genes such as IGFBP1, G6PC and PCK1. Important regulator of cell death acting downstream of CDK1, PKB/AKT1 and STK4/MST1. Promotes neural cell death. Mediates insulin action on adipose tissue. Regulates the expression of adipogenic genes such as PPARG during preadipocyte differentiation and, adipocyte size and adipose tissue-specific gene expression in response to excessive calorie intake. Regulates the transcriptional activity of GADD45A and repair of nitric oxide-damaged DNA in beta-cells. Required for the autophagic cell death induction in response to starvation or oxidative stress in a transcription-independent manner. Mediates the function of MLIP in cardiomyocytes hypertrophy and cardiac remodeling (By similarity). |
Uniprot ID | Q12778 |
Molecular Weight | 69 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)" provided in?
This item is provided in "Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
This target may also be called "FKH1;FKHR;forkhead box protein O1;forkhead box protein O1A;Forkhead in rhabdomyosarcoma;forkhead, Drosophila, homolog of, in rhabdomyosarcoma;FOXO1A." in publications.
-
What is the shipping cost for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "69 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FOXO1A Antibody (Phospho-Ser329) (OAAF07382)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FOXO1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FOXO1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FOXO1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FOXO1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FOXO1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FOXO1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.