SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30180_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP30180_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-FKBP4 (ARP30180_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 75%
Peptide SequenceSynthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
Concentration0.5 mg/ml
Blocking PeptideFor anti-FKBP4 (ARP30180_P050-FITC) antibody is Catalog # AAP30180 (Previous Catalog # AAPS08908)
Sample Type Confirmation

FKBP4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

ReferenceRuan,B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 33-38
Gene SymbolFKBP4
Gene Full NameFK506 binding protein 4, 59kDa
Alias SymbolsHBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase
NCBI Gene Id2288
Protein NamePeptidyl-prolyl cis-trans isomerase FKBP4
Description of TargetFKBP4 is a component of unactivated mammalian steroid receptor complexes that sediment at 8-10 S. It may have a rotamase activity. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP30416
Protein Accession #NP_002005
Nucleotide Accession #NM_002014
Protein Size (# AA)459
Molecular Weight52kDa
Protein InteractionsHSP90AB1; HSP90AA1; RPS10-NUDT3; CDC37L1; LSM7; CACYBP; CHORDC1; GLMN; CDC37; SUGT1; USP19; PTGES3; AHSA1; UBC; MDM2; MGEA5; TPM3; MCM4; MCM3; SQSTM1; Nr3c1; S100A6; S100A2; S100A1; gag-pol; VCAM1; TAF9; SNCA; SARDH; UBD; PGR; NR3C2; AR; CDK2; SIRT7; SH3B
  1. What is the species homology for "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    This target may also be called "HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase" in publications.

  5. What is the shipping cost for "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FKBP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FKBP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FKBP4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FKBP4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FKBP4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FKBP4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)
Your Rating
We found other products you might like!