- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for FDPS Antibody (OAAL00101) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 3A6 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | FDPS (NP_001995.1, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | FDPS |
|---|---|
| Gene Full Name | farnesyl diphosphate synthase |
| Alias Symbols | (2E,6E)-farnesyl diphosphate synthase;farnesyl pyrophosphate synthase;farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase;FPP synthase;FPP synthetase;FPPS;FPS;POROK9. |
| NCBI Gene Id | 2224 |
| Protein Name | farnesyl pyrophosphate synthase isoform a [Homo sapiens]|Homo sapiens farnesyl diphosphate synthase (FDPS), transcript variant 1, mRNA |
| Description of Target | This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_001995.1 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_002004 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FDPS Antibody (OAAL00101)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "FDPS Antibody (OAAL00101)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "FDPS Antibody (OAAL00101)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FDPS Antibody (OAAL00101)"?
This target may also be called "(2E,6E)-farnesyl diphosphate synthase;farnesyl pyrophosphate synthase;farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase;FPP synthase;FPP synthetase;FPPS;FPS;POROK9." in publications.
-
What is the shipping cost for "FDPS Antibody (OAAL00101)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FDPS Antibody (OAAL00101)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FDPS Antibody (OAAL00101)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FDPS Antibody (OAAL00101)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FDPS"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FDPS"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FDPS"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FDPS"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FDPS"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FDPS"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
