Size:100 ul
$319.00
In stock
SKU
ARP37443_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37443_P050-FITC Conjugated

ARP37443_P050-HRP Conjugated

ARP37443_P050-Biotin Conjugated

Fbxw7 Antibody - middle region (ARP37443_P050)

Catalog#: ARP37443_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded mouse brain tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133448 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse Fbxw7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-Fbxw7 (ARP37443_P050)
Peptide Sequence Synthetic peptide located within the following region: GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Fbxw7 (ARP37443_P050) antibody is Catalog # AAP37443 (Previous Catalog # AAPP09584)
Datasheets/Manuals Printable datasheet for anti-Fbxw7 (ARP37443_P050) antibody
Publications

Huang, H. et al. NF-κB1 inhibits c-Myc protein degradation through suppression of FBW7 expression. Oncotarget 5, 493-505 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24457827

Gene Symbol Fbxw7
Official Gene Full Name F-box and WD-40 domain protein 7
Alias Symbols 1110001A17Rik, AGO, Cdc4, Fbw7, Fbwd6, Fbx30, Fbxo30, Fbxw6, SEL-10
NCBI Gene Id 50754
Protein Name F-box/WD repeat-containing protein 7
Description of Target Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1.
Swissprot Id Q8VBV4
Protein Accession # NP_536353
Nucleotide Accession # NM_080428
Protein Size (# AA) 629
Molecular Weight 70kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Fbxw7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Fbxw7.
Protein Interactions Skp1a; CREB3L1; CREB3L2; Cul1; Prkcz; Prkce; Prkcd; Prkcb; Prkca; Pten; Mcl1; CEBPA; Pin1; MYB; Npm1; Jun;
Write Your Own Review
You're reviewing:Fbxw7 Antibody - middle region (ARP37443_P050)
Your Rating