Search Antibody, Protein, and ELISA Kit Solutions

Fbxw7 Antibody - middle region (ARP37443_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37443_P050-FITC Conjugated

ARP37443_P050-HRP Conjugated

ARP37443_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded mouse brain tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
F-box and WD-40 domain protein 7
NCBI Gene Id:
Protein Name:
F-box/WD repeat-containing protein 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
1110001A17Rik, AGO, Cdc4, Fbw7, Fbwd6, Fbx30, Fbxo30, Fbxw6, SEL-10
Replacement Item:
This antibody may replace item sc-133448 from Santa Cruz Biotechnology.
Description of Target:
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Fbxw7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Fbxw7.
The immunogen is a synthetic peptide directed towards the middle region of mouse Fbxw7
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-Fbxw7 (ARP37443_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Skp1a; CREB3L1; CREB3L2; Cul1; Prkcz; Prkce; Prkcd; Prkcb; Prkca; Pten; Mcl1; CEBPA; Pin1; MYB; Npm1; Jun;
Blocking Peptide:
For anti-Fbxw7 (ARP37443_P050) antibody is Catalog # AAP37443 (Previous Catalog # AAPP09584)
Printable datasheet for anti-Fbxw7 (ARP37443_P050) antibody

Huang, H. et al. NF-κB1 inhibits c-Myc protein degradation through suppression of FBW7 expression. Oncotarget 5, 493-505 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24457827

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...