Fbxw7 Peptide - middle region (AAP37443)

Data Sheet
 
Sku AAP37443
Old sku AAPP09584
Price $99.00
Name Fbxw7 Peptide - middle region (AAP37443)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Fbxw7
Alias symbols 1110001A17Rik, AGO, Cdc4, Fbw7, Fbwd6, Fbx30, Fbxo30, Fbxw6, SEL-10
Gene id 50754
Description of target Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1.
Swissprot id Q8VBV4
Protein accession num NP_536353
Nucleotide accession num NM_080428
Protein size 629 amino acids
Molecular weight 70kDa
Species reactivity Mouse
Application IHC, WB
Peptide sequence GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG
Partner proteins Jun,Npm1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Fbxw7 Antibody(ARP37443_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com