Sku |
AAP37443 |
Old sku |
AAPP09584 |
Price |
$99.00 |
Name |
Fbxw7 Peptide - middle region (AAP37443) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Fbxw7 |
Alias symbols |
1110001A17Rik, AGO, Cdc4, Fbw7, Fbwd6, Fbx30, Fbxo30, Fbxw6, SEL-10 |
Gene id |
50754 |
Description of target |
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. |
Swissprot id |
Q8VBV4 |
Protein accession num |
NP_536353 |
Nucleotide accession num |
NM_080428 |
Protein size |
629 amino acids |
Molecular weight |
70kDa |
Species reactivity |
Mouse |
Application |
IHC, WB |
Peptide sequence |
GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG |
Partner proteins |
Jun,Npm1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Fbxw7 Antibody(ARP37443_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |