Search Antibody, Protein, and ELISA Kit Solutions

FANCG Antibody - C-terminal region : FITC (ARP76144_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76144_P050 Unconjugated

ARP76144_P050-HRP Conjugated

ARP76144_P050-Biotin Conjugated

Gene Symbol:
FANCG
NCBI Gene Id:
2189
Swissprot Id:
O15287
Protein Accession #:
NP_004620
Alias Symbols:
FANCG, XRCC9,
Replacement Item:
This antibody may replace item sc-100740 from Santa Cruz Biotechnology.
Description of Target:
FANCG is a DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. It may be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. It is a candidate tumor suppressor gene.
Protein Size (# AA):
622
Molecular Weight:
68kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FANCG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FANCG.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FANCG
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-FANCG (ARP76144_P050-FITC) antibody is Catalog # AAP76144
Datasheets/Manuals:
Printable datasheet for anti-FANCG (ARP76144_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...